Adinda Wens
Universitätsmedizin Göttingen
Institut für Neuroimmunologie und Multiple
Sklerose Forschung
Von-Siebold-Str. 3 a, 37075 Göttingen
Tel: +49-(0)-551-39-61160
E-mail: adinda.wens@med.uni-goettingen.de
View primary antibody
Basic data
| PID | primary-0038 |
| EPIC PID | primary-0038 |
| Research group | RG Stadelmann-Nessler |
| Quality (mean) | no score (0.00) |
| Sharing level | Public |
Antibody data
| Antigen symbol | P2RY12 |
| Antibody Registry ID(s) | AB_2810254 |
| Name | P2Y12/P2RY12 Antibody |
| Alternative name | SP1999 |
| Lab ID | |
| Tag / Fluorophore | |
| Raised in | rabbit |
| Reacts with | Human, canine, feline |
| Clone | |
| Isotype | IgG |
| Clonality | polyclonal |
| Demasking | unknown |
| Antigen | Against a recombinant protein corresponding to amino acids: KSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM |
| Crafted By | company |
| Company / Manufacturer | Novus Biologicals |
| Catalog no. | NBP2-33870 |
| Lot no. | |
| Description | Western Blot 0.04 - 0.4 ug/ml Immunocytochemistry/Immunofluorescence 0.25 - 2 ug/mL Immunohistochemistry 1:1000 - 1:2500 Immunohistochemistry-Frozen Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
| Localization | |
| Storage instruction | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Receipt date | 2021-11-11 00:00:00 |
| Preparation date | 2021-11-11 00:00:00 |
| Created by | , |
| Last modified | , |
External links
Applications
No application comments yet.
Linked publications
Concurrent axon and myelin destruction differentiates X‐linked adrenoleukodystrophy from multiple sclerosis
Bergner CG, Genc N, Hametner S, Franz J, Meer F, Mitkovski M, Weber MS, Stoltenburg‐Didinger G, Kühl J, Köhler W, Brück W, Gärtner J, Stadelmann C
Glia 2021 : 10.1002/glia.24042
