Adinda Wens
Technische Universität München
Fakultät für Medizin
Lehrstuhl für Molekulare Neurobiologie
Feodor-Lynen Strasse 17, 81377 Munich
Tel: +49-(0)-89-440046463
View primary antibody
Basic data
PID | primary-0038 |
EPIC PID | primary-0038 |
Research group | RG Stadelmann-Nessler |
Quality (mean) | no score (0.00) |
Sharing level | Public |
Antibody data
Antigen symbol | P2RY12 |
Antibody Registry ID(s) | AB_2810254 |
Name | P2Y12/P2RY12 Antibody |
Alternative name | SP1999 |
Lab ID | |
Tag / Fluorophore | |
Raised in | rabbit |
Reacts with | Human, canine, feline |
Clone | |
Isotype | IgG |
Clonality | polyclonal |
Demasking | unknown |
Antigen | Against a recombinant protein corresponding to amino acids: KSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM |
Crafted By | company |
Company / Manufacturer | Novus Biologicals |
Catalog no. | NBP2-33870 |
Lot no. | |
Description | Western Blot 0.04 - 0.4 ug/ml Immunocytochemistry/Immunofluorescence 0.25 - 2 ug/mL Immunohistochemistry 1:1000 - 1:2500 Immunohistochemistry-Frozen Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
Localization | |
Storage instruction | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Receipt date | 2021-11-11 00:00:00 |
Preparation date | 2021-11-11 00:00:00 |
Created by | , |
Last modified | , |
External links
Applications
No application comments yet.
Linked publications
Concurrent axon and myelin destruction differentiates X‐linked adrenoleukodystrophy from multiple sclerosis
Bergner CG, Genc N, Hametner S, Franz J, Meer F, Mitkovski M, Weber MS, Stoltenburg‐Didinger G, Kühl J, Köhler W, Brück W, Gärtner J, Stadelmann C
Glia 2021 : 10.1002/glia.24042