Adinda Wens
Technische Universität München
Fakultät für Medizin
Lehrstuhl für Molekulare Neurobiologie
Feodor-Lynen Strasse 17, 81377 Munich
Tel: +49-(0)-89-440046463
Primary antibodies
Search
AG | PID | Antigen Symbol | Antibody Registry | Name | Clonality | Antigen | Quality | Company | Catalog no. |
---|---|---|---|---|---|---|---|---|---|
![]() | primary-0104 | PARP1 | AB_10699459 | poly(ADP-ribose) polymerase 1 | monoclonal | large fragment (89 kDa) of human PARP1 protein produced by caspase cleavage. | - | Cell Signaling Technology | 5625 |
![]() | primary-0103 | GALNS | AB_11152499 | GALNS Polyclonal Antibody | polyclonal | - | Thermo Fisher Scientific (Invitrogen) | PA5-22098 | |
![]() | primary-0102 | ARSA | AB_1078220 | Anti-ARSA antibody produced in rabbit | polyclonal | LLLGTGKSPRQSLFFYPSYPDEVRGVFAVRTGKYKAHFFTQGSAHSDTTADPACHASSSLTAHEPPLLYDLSKDPGENYNLLGGVAGATPEVLQALKQLQLLKAQLDAAVTFGPSQ | - | HPA005554 | |
![]() | primary-0101 | NICA | AB_477259 | Anti-Nicastrin antibody produced in rabbit | polyclonal | synthetic peptide corresponding to the C-terminus of human nicastrin (amino acids 693-709) conjugated to KLH. | - | N1660 | |
![]() | primary-0100 | APP | AB_2289606 | Recombinant Anti-Amyloid Precursor Protein antibody [Y188] | monoclonal | Synthetic peptide. This information is proprietary to Abcam and/or its suppliers. | - | Abcam | ab32136 |
![]() | primary-0097 | TREM2 | AB_2799888 | TREM2 (E7P8J) Rabbit mAb (Carboxy-terminal Antigen) | monoclonal | - | Cell Signaling Technology | 76765 | |
![]() | primary-0096 | BACE1 | AB_1903900 | BACE1 (D10E5) Rabbit mAb | monoclonal | - | Cell Signaling Technology | 5606 | |
![]() | primary-0091 | PSN2 | AB_882202 | Recombinant Anti-Presenilin 2/AD5 antibody [EP1515Y] | monoclonal | Synthetic peptide within Human Presenilin 2/AD5 aa 300-400 (C terminal). The exact sequence is proprietary. | - | Abcam | ab51249 |
![]() | primary-0090 | ApoE | AB_2798191 | ApoE (pan) (D7I9N) Rabbit mAb | monoclonal | - | Cell Signaling Technology | 13366 | |
![]() | primary-0089 | APP | AB_2798041 | β-Amyloid (1-42) (D3E10) Rabbit mAb | unknown | - | Cell Signaling Technology | 12843 | |
![]() | primary-0088 | APP | AB_2056967 | APP antibody | polyclonal | Synthetic peptide corresponding to AA 756 to 770 from rat APP (UniProt Id: P08592) | - | Synaptic Systems | 127 003 |
![]() | primary-0087 | APP | AB_258409 | Anti-Amyloid Precursor Protein, C-Terminal antibody produced in rabbit | polyclonal | - | Sigma-Aldrich | A8717 | |
![]() | primary-0086 | GFAP | AB_563739 | Anti-Glial Fibrillary Acidic Protein Monoclonal Antibody, Unconjugated | monoclonal | - | Leica Biosystems | NCL-GFAP-GA5 | |
![]() | primary-0085 | BACE1 | Recombinant Anti-BACE1 antibody [EPR19523] (ab183612) | monoclonal | - | Abcam | ab183612 | ||
![]() | primary-0084 | CNP | AB_2665789 | Monoclonal Anti-CNP Antibody | monoclonal | - | Atlas Antibodies | AMAb91072 | |
![]() | primary-0083 | AB_2564653 | Purified anti-β-Amyloid, 1-16 Antibody (Previously Covance catalog# SIG-39320) | monoclonal | - | BioLegend | 803001 | ||
![]() | primary-0082 | Iba1 | AB_839504 | Anti Iba1, Rabbit (for Immunocytochemistry) | polyclonal | Synthetic peptide (Iba1 C-terminal sequence) | - | FUJIFILM Wako Shibayagi | 019-19741 |
![]() | primary-0076 | TFAM | AB_10717737 | TFAM MaxPab rabbit polyclonal antibody (D01) | polyclonal | TFAM (NP_003192.1, 1 a.a. ~ 246 a.a) full-length human protein. | - | Abnova | H00007019-D01 |
![]() | primary-0075 | BrdU | AB_305426 | Anti-BrdU antibody [BU1/75 (ICR1)] - Proliferation Marker | monoclonal | The details of the immunogen for this antibody are not available. | - | Abcam | ab6326 |
![]() | primary-0074 | AB_470907 | Anti-ds DNA antibody [35I9 DNA] - BSA and Azide free | monoclonal | The details of the immunogen for this antibody are not available. | - | Abcam | ab27156 | |
![]() | primary-0073 | IMMT | AB_2127193 | Mitofilin antibody | polyclonal | Mitofilin fusion protein Ag0102 | - | Proteintech | 10179-1-AP |
![]() | primary-0072 | AB_221544 | Alexa Fluor 488 Polyclonal Antibody | polyclonal | Alexa Fluor 488 coupled to carrier protein | - | Thermo Fisher Scientific (Invitrogen) | A-11094 | |
![]() | primary-0071 | NEFH | AB_477257 | Anti-Neurofilament 200 (Phos. and Non-Phos.) antibody | monoclonal | C-terminal segment of enzymatically dephosphorylated pig neurofilament 200. | - | Sigma-Aldrich | N0142 |
![]() | primary-0070 | AQP4 | AB_258270 | Anti-Water Channel Aquaporin 4 antibody | polyclonal | recombinant fusion protein corresponding to residues 249-323 of rat AQP4 fused to GST. | - | Sigma-Aldrich | A5971 |
![]() | primary-0068 | ACE2 | AB_10732845 | ACE2 antibody | polyclonal | ACE2 fusion protein Ag15455 | - | Proteintech | 21115-1-AP |