Adinda Wens
Technische Universität München
Fakultät für Medizin
Lehrstuhl für Molekulare Neurobiologie
Feodor-Lynen Strasse 17, 81377 Munich
Tel: +49-(0)-89-440046463
Primary antibodies
Search
AG | PID | Antigen Symbol | Antibody Registry | Name | Clonality | Antigen | Quality | Company | Catalog no. |
---|---|---|---|---|---|---|---|---|---|
primary-0055 | AB_2619949 | Chicken anti-IBA1 | polyclonal | - | Synaptic Systems | 234 006 | |||
primary-0056 | AB_442102 | Ki-67 antibody | polyclonal | Prokaryotic recombinant fusion protein corresponding to a 1086bp Ki67 motif-containing cDNA fragment | - | Leica Biosystems | NCL-Ki67p | ||
primary-0057 | AB_630987 | caspase-3 (L-18) antibody | polyclonal | - | Santa Cruz Biotechnology | sc-1225 | |||
primary-0060 | AB_2620122 | Anti-Zbtb 20 antibody | polyclonal | - | Synaptic Systems | 362 003 | |||
primary-0061 | S100 | AB_10013383 | S100 antibody | polyclonal | S100 isolated from cow brain. | - | Agilent (Dako) | Z0311 | |
primary-0065 | OMP | AB_664696 | Anti-Olfactory Marker Protein Antibody | polyclonal | Olfactory Marker Protein | - | Wako | 019-22291 | |
primary-0067 | NEFH | AB_477272 | Anti-Neurofilament 200 antibody | polyclonal | Neurofilament 200 from spinal cord of bovine | - | Sigma-Aldrich | N4142 | |
primary-0068 | ACE2 | AB_10732845 | ACE2 antibody | polyclonal | ACE2 fusion protein Ag15455 | - | Proteintech | 21115-1-AP | |
primary-0070 | AQP4 | AB_258270 | Anti-Water Channel Aquaporin 4 antibody | polyclonal | recombinant fusion protein corresponding to residues 249-323 of rat AQP4 fused to GST. | - | Sigma-Aldrich | A5971 | |
primary-0072 | AB_221544 | Alexa Fluor 488 Polyclonal Antibody | polyclonal | Alexa Fluor 488 coupled to carrier protein | - | Thermo Fisher Scientific (Invitrogen) | A-11094 | ||
primary-0073 | IMMT | AB_2127193 | Mitofilin antibody | polyclonal | Mitofilin fusion protein Ag0102 | - | Proteintech | 10179-1-AP | |
primary-0076 | TFAM | AB_10717737 | TFAM MaxPab rabbit polyclonal antibody (D01) | polyclonal | TFAM (NP_003192.1, 1 a.a. ~ 246 a.a) full-length human protein. | - | Abnova | H00007019-D01 | |
primary-0082 | Iba1 | AB_839504 | Anti Iba1, Rabbit (for Immunocytochemistry) | polyclonal | Synthetic peptide (Iba1 C-terminal sequence) | - | FUJIFILM Wako Shibayagi | 019-19741 | |
primary-0087 | APP | AB_258409 | Anti-Amyloid Precursor Protein, C-Terminal antibody produced in rabbit | polyclonal | - | Sigma-Aldrich | A8717 | ||
primary-0088 | APP | AB_2056967 | APP antibody | polyclonal | Synthetic peptide corresponding to AA 756 to 770 from rat APP (UniProt Id: P08592) | - | Synaptic Systems | 127 003 | |
primary-0101 | NICA | AB_477259 | Anti-Nicastrin antibody produced in rabbit | polyclonal | synthetic peptide corresponding to the C-terminus of human nicastrin (amino acids 693-709) conjugated to KLH. | - | N1660 | ||
primary-0102 | ARSA | AB_1078220 | Anti-ARSA antibody produced in rabbit | polyclonal | LLLGTGKSPRQSLFFYPSYPDEVRGVFAVRTGKYKAHFFTQGSAHSDTTADPACHASSSLTAHEPPLLYDLSKDPGENYNLLGGVAGATPEVLQALKQLQLLKAQLDAAVTFGPSQ | - | HPA005554 | ||
primary-0103 | GALNS | AB_11152499 | GALNS Polyclonal Antibody | polyclonal | - | Thermo Fisher Scientific (Invitrogen) | PA5-22098 | ||
primary-0051 | AB_2110656 | Anti-Glutamine Synthetase, clone GS-6 antibody | unknown | - | Millipore | MAB302 | |||
primary-0058 | AB_2620065 | Anti-Ctip 2 antibody | unknown | Ctip 2 (C-terminus) | - | Synaptic Systems | 325 005 | ||
primary-0089 | APP | AB_2798041 | β-Amyloid (1-42) (D3E10) Rabbit mAb | unknown | - | Cell Signaling Technology | 12843 |