Adinda Wens
Technische Universität München
Fakultät für Medizin
Lehrstuhl für Molekulare Neurobiologie
Feodor-Lynen Strasse 17, 81377 Munich
Tel: +49-(0)-89-440046463
Primary antibodies
Search
AG | PID | Antigen Symbol | Antibody Registry | Name | Clonality | Antigen | Quality | Company | Catalog no. |
---|---|---|---|---|---|---|---|---|---|
primary-0010 | OLIG2 | AB_494617 | OLIG2 anti-human rabbit IgG affinity purify | polyclonal | Synthetic peptide in portion of C-terminus of Human Olig2 | - | Immuno-Biological Laboratories (IBL) | 18953 | |
primary-0038 | P2RY12 | AB_2810254 | P2Y12/P2RY12 Antibody | polyclonal | Against a recombinant protein corresponding to amino acids: KSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM | - | Novus Biologicals | NBP2-33870 | |
primary-0062 | KRT | AB_2132885 | Pan-Keratin antibody | monoclonal | Human epidermal callus1 | - | Agilent (Dako) | M3515 | |
primary-0005 | PECAM1 | AB_2801330 | PECAM-1 Antikörper (H-3) | monoclonal | aa 699-727 at the C-terminus | - | Santa Cruz Biotechnology | sc-376764 | |
primary-0104 | PARP1 | AB_10699459 | poly(ADP-ribose) polymerase 1 | monoclonal | large fragment (89 kDa) of human PARP1 protein produced by caspase cleavage. | - | Cell Signaling Technology | 5625 | |
primary-0035 | CNP | AB_2728547 | Purified anti-Myelin CNPase Antibody | monoclonal | - | BioLegend | 836403 | ||
primary-0042 | NEFH | AB_2715852 | Purified anti-Neurofilament H (NF-H), Nonphosphorylated Antibody | monoclonal | - | BioLegend | 801702 | ||
primary-0044 | NEFH | AB_2566782 | Purified anti-Neurofilament Marker (pan axonal, cocktail) Antibody | monoclonal | Homogenized hypothalami recovered from Fischer 344 rats. | - | BioLegend | 837904 | |
primary-0083 | AB_2564653 | Purified anti-β-Amyloid, 1-16 Antibody (Previously Covance catalog# SIG-39320) | monoclonal | - | BioLegend | 803001 | |||
primary-0100 | APP | AB_2289606 | Recombinant Anti-Amyloid Precursor Protein antibody [Y188] | monoclonal | Synthetic peptide. This information is proprietary to Abcam and/or its suppliers. | - | Abcam | ab32136 | |
primary-0085 | BACE1 | Recombinant Anti-BACE1 antibody [EPR19523] (ab183612) | monoclonal | - | Abcam | ab183612 | |||
primary-0066 | TUBB3 | Recombinant Anti-beta III Tubulin antibody | monoclonal | Synthetic peptide within Human beta III Tubulin aa 400 to the C-terminus. | - | Abcam | ab215037 | ||
primary-0091 | PSN2 | AB_882202 | Recombinant Anti-Presenilin 2/AD5 antibody [EP1515Y] | monoclonal | Synthetic peptide within Human Presenilin 2/AD5 aa 300-400 (C terminal). The exact sequence is proprietary. | - | Abcam | ab51249 | |
primary-0059 | Recombinant Anti-TBR1 antibody [EPR8138(2)] | monoclonal | - | Abcam | ab183032 | ||||
primary-0032 | TPPP | AB_2050408 | Recombinant Anti-TPPP antibody | monoclonal | Synthetic peptide within Human TPPP. The exact sequence is proprietary. | - | Abcam | ab92305 | |
primary-0061 | S100 | AB_10013383 | S100 antibody | polyclonal | S100 isolated from cow brain. | - | Agilent (Dako) | Z0311 | |
primary-0063 | S100A9 | AB_1007174 | S100A9 mouse monoclonal antibody | monoclonal | Cultured Human monocytes. | - | Origene (Acris) | BM4026B | |
primary-0011 | SARS-CoV-2 (2019-nCoV) Spike RBD Antibody, Rabbit PAb, Antigen Affinity Purified | polyclonal | Recombinant SARS-CoV-2 / 2019-nCoV Spike/RBD Protein (Catalog#40592-V05H) | - | SinoBiological | 40592-T62 | |||
primary-0076 | TFAM | AB_10717737 | TFAM MaxPab rabbit polyclonal antibody (D01) | polyclonal | TFAM (NP_003192.1, 1 a.a. ~ 246 a.a) full-length human protein. | - | Abnova | H00007019-D01 | |
primary-0097 | TREM2 | AB_2799888 | TREM2 (E7P8J) Rabbit mAb (Carboxy-terminal Antigen) | monoclonal | - | Cell Signaling Technology | 76765 | ||
primary-0089 | APP | AB_2798041 | β-Amyloid (1-42) (D3E10) Rabbit mAb | unknown | - | Cell Signaling Technology | 12843 |