Adinda Wens
Technische Universität München
Fakultät für Medizin
Lehrstuhl für Molekulare Neurobiologie
Feodor-Lynen Strasse 17, 81377 Munich
Tel: +49-(0)-89-440046463
Primary antibodies
Search
AG | PID | Antigen Symbol | Antibody Registry | Name | Clonality | Antigen | Quality | Company | Catalog no. |
---|---|---|---|---|---|---|---|---|---|
primary-0051 | AB_2110656 | Anti-Glutamine Synthetase, clone GS-6 antibody | unknown | - | Millipore | MAB302 | |||
primary-0058 | AB_2620065 | Anti-Ctip 2 antibody | unknown | Ctip 2 (C-terminus) | - | Synaptic Systems | 325 005 | ||
primary-0089 | APP | AB_2798041 | β-Amyloid (1-42) (D3E10) Rabbit mAb | unknown | - | Cell Signaling Technology | 12843 | ||
primary-0002 | NeuN | AB_11205760 | Anti-NeuN Antibody | polyclonal | GST-tagged recombinant fragment corresponding to the first 97 amino acids from the N-terminal region of murine NeuN. | - | Milipore | ABN91 | |
primary-0003 | AB_221570 | GFP Polyclonal Antibody | polyclonal | The GFP was isolated directly from the jellyfish Aequorea victoria. | - | A-6455 | |||
primary-0004 | COL4A1 | AB_2721907 | Goat Anti-Type IV Collagen-UNLB | polyclonal | - | SouthernBiotech | 1340-01 | ||
primary-0006 | AQP4 | AB_2039734 | Anti-Aquaporin 4 (AQP4) (249-323) Antibody | polyclonal | GST fusion protein with the sequence EYVFCPDVELKRRLKEAFSKAAQQTKGSYMEVEDNRSQVETEDLILKPGVVHVIDIDRGDEKKGKDSSGEVLSSV | - | Alomone Labs | AQP-004 | |
primary-0007 | ACE2 | AB_355722 | Human/Mouse/Rat/Hamster ACE-2 Antibody | polyclonal | Mouse myeloma cell line NS0-derived recombinant human ACE-2, Gln18-Ser740, Accession # Q9BYF1 | - | R&D Systems | AF933 | |
primary-0010 | OLIG2 | AB_494617 | OLIG2 anti-human rabbit IgG affinity purify | polyclonal | Synthetic peptide in portion of C-terminus of Human Olig2 | - | Immuno-Biological Laboratories (IBL) | 18953 | |
primary-0011 | SARS-CoV-2 (2019-nCoV) Spike RBD Antibody, Rabbit PAb, Antigen Affinity Purified | polyclonal | Recombinant SARS-CoV-2 / 2019-nCoV Spike/RBD Protein (Catalog#40592-V05H) | - | SinoBiological | 40592-T62 | |||
primary-0012 | TUBA1A | AB_301787 | Anti-alpha Tubulin antibody - Microtubule Marker | polyclonal | - | Abcam | ab15246 | ||
primary-0026 | AB_839504 | Anti Iba1, Rabbit antibody | polyclonal | - | FUJIFILM Wako Shibayagi | 019-19741 | |||
primary-0027 | AB_570666 | Anti-Olig-2 Antibody | polyclonal | - | Millipore | AB9610 | |||
primary-0030 | GFAP | AB_10013382 | Glial Fibrillary Acidic Protein (Multipurpose) antibody | polyclonal | - | Agilent (Dako) | Z0334 | ||
primary-0037 | TMEM119 | AB_2681645 | Anti-TMEM119 antibody | polyclonal | transmembrane protein 119 recombinant protein epitope signature tag (PrEST) | - | Sigma-Aldrich (Atlas Antibodies) | HPA051870 | |
primary-0038 | P2RY12 | AB_2810254 | P2Y12/P2RY12 Antibody | polyclonal | Against a recombinant protein corresponding to amino acids: KSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM | - | Novus Biologicals | NBP2-33870 | |
primary-0050 | AB_300798 | Anti-GFP antibody | polyclonal | GFP | - | Abcam | ab13970 | ||
primary-0055 | AB_2619949 | Chicken anti-IBA1 | polyclonal | - | Synaptic Systems | 234 006 | |||
primary-0056 | AB_442102 | Ki-67 antibody | polyclonal | Prokaryotic recombinant fusion protein corresponding to a 1086bp Ki67 motif-containing cDNA fragment | - | Leica Biosystems | NCL-Ki67p | ||
primary-0057 | AB_630987 | caspase-3 (L-18) antibody | polyclonal | - | Santa Cruz Biotechnology | sc-1225 | |||
primary-0060 | AB_2620122 | Anti-Zbtb 20 antibody | polyclonal | - | Synaptic Systems | 362 003 | |||
primary-0061 | S100 | AB_10013383 | S100 antibody | polyclonal | S100 isolated from cow brain. | - | Agilent (Dako) | Z0311 | |
primary-0065 | OMP | AB_664696 | Anti-Olfactory Marker Protein Antibody | polyclonal | Olfactory Marker Protein | - | Wako | 019-22291 | |
primary-0067 | NEFH | AB_477272 | Anti-Neurofilament 200 antibody | polyclonal | Neurofilament 200 from spinal cord of bovine | - | Sigma-Aldrich | N4142 | |
primary-0068 | ACE2 | AB_10732845 | ACE2 antibody | polyclonal | ACE2 fusion protein Ag15455 | - | Proteintech | 21115-1-AP |