Adinda Wens
Universitätsmedizin Göttingen
Institut für Neuroimmunologie und Multiple
Sklerose Forschung
Von-Siebold-Str. 3 a, 37075 Göttingen
Tel: +49-(0)-551-39-61160
E-mail: adinda.wens@med.uni-goettingen.de
AG | PID | Antigen Symbol | Antibody Registry | Name | Clonality | Antigen | Quality | Company | Catalog no. |
---|---|---|---|---|---|---|---|---|---|
![]() | primary-0067 | NEFH | AB_477272 | Anti-Neurofilament 200 antibody | polyclonal | Neurofilament 200 from spinal cord of bovine | - | Sigma-Aldrich | N4142 |
![]() | primary-0066 | TUBB3 | Recombinant Anti-beta III Tubulin antibody | monoclonal | Synthetic peptide within Human beta III Tubulin aa 400 to the C-terminus. | - | Abcam | ab215037 | |
![]() | primary-0065 | OMP | AB_664696 | Anti-Olfactory Marker Protein Antibody | polyclonal | Olfactory Marker Protein | - | Wako | 019-22291 |
![]() | primary-0064 | CD56 | AB_321501 | CD56 antibody | monoclonal | Human retinoblastoma tumour cells. | - | Bio Rad (Serotec) | MCA591 |
![]() | primary-0063 | S100A9 | AB_1007174 | S100A9 mouse monoclonal antibody | monoclonal | Cultured Human monocytes. | - | Origene (Acris) | BM4026B |
![]() | primary-0062 | KRT | AB_2132885 | Pan-Keratin antibody | monoclonal | Human epidermal callus1 | - | Agilent (Dako) | M3515 |
![]() | primary-0061 | S100 | AB_10013383 | S100 antibody | polyclonal | S100 isolated from cow brain. | - | Agilent (Dako) | Z0311 |
![]() | primary-0060 | AB_2620122 | Anti-Zbtb 20 antibody | polyclonal | - | Synaptic Systems | 362 003 | ||
![]() | primary-0059 | Recombinant Anti-TBR1 antibody [EPR8138(2)] | monoclonal | - | Abcam | ab183032 | |||
![]() | primary-0058 | AB_2620065 | Anti-Ctip 2 antibody | unknown | Ctip 2 (C-terminus) | - | Synaptic Systems | 325 005 | |
![]() | primary-0057 | AB_630987 | caspase-3 (L-18) antibody | polyclonal | - | Santa Cruz Biotechnology | sc-1225 | ||
![]() | primary-0056 | AB_442102 | Ki-67 antibody | polyclonal | Prokaryotic recombinant fusion protein corresponding to a 1086bp Ki67 motif-containing cDNA fragment | - | Leica Biosystems | NCL-Ki67p | |
![]() | primary-0055 | AB_2619949 | Chicken anti-IBA1 | polyclonal | - | Synaptic Systems | 234 006 | ||
![]() | primary-0051 | AB_2110656 | Anti-Glutamine Synthetase, clone GS-6 antibody | unknown | - | Millipore | MAB302 | ||
![]() | primary-0050 | AB_300798 | Anti-GFP antibody | polyclonal | GFP | - | Abcam | ab13970 | |
![]() | primary-0049 | AB_260581 | Monoclonal Anti-c-Myc antibody produced in mouse | monoclonal | c-Myc human | - | Sigma-Aldrich | M5546 | |
![]() | primary-0044 | NEFH | AB_2566782 | Purified anti-Neurofilament Marker (pan axonal, cocktail) Antibody | monoclonal | Homogenized hypothalami recovered from Fischer 344 rats. | - | BioLegend | 837904 |
![]() | primary-0043 | NEFH | AB_2565349 | Anti-Neurofilament H & M (NF-H/NF-M), Hypophosphorylated Antibody | monoclonal | - | BioLegend | 835601 | |
![]() | primary-0042 | NEFH | AB_2715852 | Purified anti-Neurofilament H (NF-H), Nonphosphorylated Antibody | monoclonal | - | BioLegend | 801702 | |
![]() | primary-0041 | NEFH | AB_2650680 | Anti-Neurofilament H (NF-H) Phosphorylated Antibody | monoclonal | - | BioLegend | 801608 | |
![]() | primary-0040 | NF | AB_2314899 | Neurofilament Protein antibody | monoclonal | Neurofilament isolated from normal adult human brain | - | Agilent (Dako) | M0762 |
![]() | primary-0039 | APP | AB_94882 | Anti-APP A4 Antibody | monoclonal | Purified recombinant Alzheimer precursor A4 (pre A4695) fusion protein. | - | Merck Millipore | MAB348 |
![]() | primary-0038 | P2RY12 | AB_2810254 | P2Y12/P2RY12 Antibody | polyclonal | Against a recombinant protein corresponding to amino acids: KSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM | - | Novus Biologicals | NBP2-33870 |
![]() | primary-0037 | TMEM119 | AB_2681645 | Anti-TMEM119 antibody | polyclonal | transmembrane protein 119 recombinant protein epitope signature tag (PrEST) | - | Sigma-Aldrich (Atlas Antibodies) | HPA051870 |
![]() | primary-0036 | BCAS1 | AB_10839529 | Anti-NaBC1 Antibody | monoclonal | raised against amino acids 365-571 of NaBC1 of human origin | - | Santa Cruz Biotechnology | sc-136342 |