Primary antibodies

Export

PID	Antigen Symbol	Antibody Registry	Name	Clonality	Antigen	Quality	Company	Catalog no.
primary-0035	CNP	AB_2728547	Purified anti-Myelin CNPase Antibody	monoclonal		-	BioLegend	836403
primary-0034	MBP	AB_305869	Anti-Myelin Basic Protein antibody	monoclonal	Full length protein corresponding to Cow Myelin Basic Protein.	-	Abcam	ab7349
primary-0033	PLP1	AB_2237198	Myelin Proteolipid Protein antibody	monoclonal	Synthetic peptide GRGTKF corresponding to C terminal region of myelin proteolipid protein	-	Bio Rad	MCA839G
primary-0032	TPPP	AB_2050408	Recombinant Anti-TPPP antibody	monoclonal	Synthetic peptide within Human TPPP. The exact sequence is proprietary.	-	Abcam	ab92305
primary-0031	MAG/GMA	AB_2042411	Anti-MAG/GMA antibody	monoclonal	Recombinant fragment corresponding to Human MAG/GMA aa 119-208.	-	Abcam	ab89780
primary-0030	GFAP	AB_10013382	Glial Fibrillary Acidic Protein (Multipurpose) antibody	polyclonal		-	Agilent (Dako)	Z0334
primary-0027		AB_570666	Anti-Olig-2 Antibody	polyclonal		-	Millipore	AB9610
primary-0026		AB_839504	Anti Iba1, Rabbit antibody	polyclonal		-	FUJIFILM Wako Shibayagi	019-19741
primary-0025		AB_2057371	Anti-APC (Ab-7) Mouse mAb (CC-1) antibody	monoclonal		-	Millipore	OP80
primary-0012	TUBA1A	AB_301787	Anti-alpha Tubulin antibody - Microtubule Marker	polyclonal		-	Abcam	ab15246
primary-0011			SARS-CoV-2 (2019-nCoV) Spike RBD Antibody, Rabbit PAb, Antigen Affinity Purified	polyclonal	Recombinant SARS-CoV-2 / 2019-nCoV Spike/RBD Protein (Catalog#40592-V05H)	-	SinoBiological	40592-T62
primary-0010	OLIG2	AB_494617	OLIG2 anti-human rabbit IgG affinity purify	polyclonal	Synthetic peptide in portion of C-terminus of Human Olig2	-	Immuno-Biological Laboratories (IBL)	18953
primary-0009			Anti-SARS spike glycoprotein antibody [3A2] - Coronavirus	monoclonal		-	Abcam	ab272420
primary-0008	NRP1	AB_2282634	neuropilin Antikörper (A-12)	monoclonal	amino acid sequence 570-855 of neuropilin in species human	-	Santa Cruz Biotechnology	sc-5307
primary-0007	ACE2	AB_355722	Human/Mouse/Rat/Hamster ACE-2 Antibody	polyclonal	Mouse myeloma cell line NS0-derived recombinant human ACE-2, Gln18-Ser740, Accession # Q9BYF1	-	R&D Systems	AF933
primary-0006	AQP4	AB_2039734	Anti-Aquaporin 4 (AQP4) (249-323) Antibody	polyclonal	GST fusion protein with the sequence EYVFCPDVELKRRLKEAFSKAAQQTKGSYMEVEDNRSQVETEDLILKPGVVHVIDIDRGDEKKGKDSSGEVLSSV	-	Alomone Labs	AQP-004
primary-0005	PECAM1	AB_2801330	PECAM-1 Antikörper (H-3)	monoclonal	aa 699-727 at the C-terminus	-	Santa Cruz Biotechnology	sc-376764
primary-0004	COL4A1	AB_2721907	Goat Anti-Type IV Collagen-UNLB	polyclonal		-	SouthernBiotech	1340-01
primary-0003		AB_221570	GFP Polyclonal Antibody	polyclonal	The GFP was isolated directly from the jellyfish Aequorea victoria.	-		A-6455
primary-0002	NeuN	AB_11205760	Anti-NeuN Antibody	polyclonal	GST-tagged recombinant fragment corresponding to the first 97 amino acids from the N-terminal region of murine NeuN.	-	Milipore	ABN91
primary-0001	NRP1	AB_1640739	anti-neuropilin-1	monoclonal		-	Abcam	AB81321

Coordination

Platform based on

Funded by

Technical Support: it-support@sfb274.de