 |
primary-0075 |
BrdU |
AB_305426 |
Anti-BrdU antibody [BU1/75 (ICR1)] - Proliferation Marker |
monoclonal |
The details of the immunogen for this antibody are not available. |
|
Abcam |
ab6326 |
|
primary-0083 |
|
AB_2564653 |
Purified anti-β-Amyloid, 1-16 Antibody (Previously Covance catalog# SIG-39320) |
monoclonal |
|
|
BioLegend |
803001 |
|
primary-0084 |
CNP |
AB_2665789 |
Monoclonal Anti-CNP Antibody |
monoclonal |
|
|
Atlas Antibodies |
AMAb91072 |
|
primary-0085 |
BACE1 |
|
Recombinant Anti-BACE1 antibody [EPR19523] (ab183612) |
monoclonal |
|
|
Abcam |
ab183612 |
|
primary-0086 |
GFAP |
AB_563739 |
Anti-Glial Fibrillary Acidic Protein Monoclonal Antibody, Unconjugated |
monoclonal |
|
|
Leica Biosystems |
NCL-GFAP-GA5 |
|
primary-0090 |
ApoE |
AB_2798191 |
ApoE (pan) (D7I9N) Rabbit mAb |
monoclonal |
|
|
Cell Signaling Technology |
13366 |
|
primary-0091 |
PSN2 |
AB_882202 |
Recombinant Anti-Presenilin 2/AD5 antibody [EP1515Y] |
monoclonal |
Synthetic peptide within Human Presenilin 2/AD5 aa 300-400 (C terminal). The exact sequence is proprietary. |
|
Abcam |
ab51249 |
|
primary-0096 |
BACE1 |
AB_1903900 |
BACE1 (D10E5) Rabbit mAb |
monoclonal |
|
|
Cell Signaling Technology |
5606 |
|
primary-0097 |
TREM2 |
AB_2799888 |
TREM2 (E7P8J) Rabbit mAb (Carboxy-terminal Antigen) |
monoclonal |
|
|
Cell Signaling Technology |
76765 |
|
primary-0100 |
APP |
AB_2289606 |
Recombinant Anti-Amyloid Precursor Protein antibody [Y188] |
monoclonal |
Synthetic peptide. This information is proprietary to Abcam and/or its suppliers. |
|
Abcam |
ab32136 |
|
primary-0104 |
PARP1 |
AB_10699459 |
poly(ADP-ribose) polymerase 1 |
monoclonal |
large fragment (89 kDa) of human PARP1 protein produced by caspase cleavage. |
|
Cell Signaling Technology |
5625 |
|
primary-0108 |
NRP1 |
AB_1640739 |
anti-neuropilin-1 |
monoclonal |
|
|
Abcam |
AB81321 |
|
primary-0002 |
NeuN |
AB_11205760 |
Anti-NeuN Antibody |
polyclonal |
GST-tagged recombinant fragment corresponding to the first 97 amino acids from the N-terminal region of murine NeuN. |
|
Milipore |
ABN91 |
|
primary-0003 |
|
AB_221570 |
GFP Polyclonal Antibody |
polyclonal |
The GFP was isolated directly from the jellyfish Aequorea victoria. |
|
|
A-6455 |
|
primary-0004 |
COL4A1 |
AB_2721907 |
Goat Anti-Type IV Collagen-UNLB |
polyclonal |
|
|
SouthernBiotech |
1340-01 |
|
primary-0006 |
AQP4 |
AB_2039734 |
Anti-Aquaporin 4 (AQP4) (249-323) Antibody |
polyclonal |
GST fusion protein with the sequence EYVFCPDVELKRRLKEAFSKAAQQTKGSYMEVEDNRSQVETEDLILKPGVVHVIDIDRGDEKKGKDSSGEVLSSV |
|
Alomone Labs |
AQP-004 |
|
primary-0007 |
ACE2 |
AB_355722 |
Human/Mouse/Rat/Hamster ACE-2 Antibody |
polyclonal |
Mouse myeloma cell line NS0-derived recombinant human ACE-2, Gln18-Ser740, Accession # Q9BYF1 |
|
R&D Systems |
AF933 |
|
primary-0010 |
OLIG2 |
AB_494617 |
OLIG2 anti-human rabbit IgG affinity purify |
polyclonal |
Synthetic peptide in portion of C-terminus of Human Olig2 |
|
Immuno-Biological Laboratories (IBL) |
18953 |
|
primary-0011 |
|
|
SARS-CoV-2 (2019-nCoV) Spike RBD Antibody, Rabbit PAb, Antigen Affinity Purified |
polyclonal |
Recombinant SARS-CoV-2 / 2019-nCoV Spike/RBD Protein (Catalog#40592-V05H) |
|
SinoBiological |
40592-T62 |
|
primary-0012 |
TUBA1A |
AB_301787 |
Anti-alpha Tubulin antibody - Microtubule Marker |
polyclonal |
|
|
Abcam |
ab15246 |
|
primary-0026 |
|
AB_839504 |
Anti Iba1, Rabbit antibody |
polyclonal |
|
|
FUJIFILM Wako Shibayagi |
019-19741 |
|
primary-0027 |
|
AB_570666 |
Anti-Olig-2 Antibody |
polyclonal |
|
|
Millipore |
AB9610 |
|
primary-0030 |
GFAP |
AB_10013382 |
Glial Fibrillary Acidic Protein (Multipurpose) antibody |
polyclonal |
|
|
Agilent (Dako) |
Z0334 |
|
primary-0037 |
TMEM119 |
AB_2681645 |
Anti-TMEM119 antibody |
polyclonal |
transmembrane protein 119 recombinant protein epitope signature tag (PrEST) |
|
Sigma-Aldrich (Atlas Antibodies) |
HPA051870 |
|
primary-0038 |
P2RY12 |
AB_2810254 |
P2Y12/P2RY12 Antibody |
polyclonal |
Against a recombinant protein corresponding to amino acids: KSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM |
|
Novus Biologicals |
NBP2-33870 |