Adinda Wens
Universitätsmedizin Göttingen
Institut für Neuroimmunologie und Multiple
Sklerose Forschung
Von-Siebold-Str. 3 a, 37075 Göttingen
Tel: +49-(0)-551-39-61160
E-mail: adinda.wens@med.uni-goettingen.de
| AG | PID | Antigen Symbol | Antibody Registry | Name | Clonality | Antigen | Quality | Company | Catalog no. |
|---|---|---|---|---|---|---|---|---|---|
![]() | primary-0001 | NRP1 | AB_1640739 | anti-neuropilin-1 | monoclonal | - | Abcam | AB81321 | |
![]() | primary-0002 | NeuN | AB_11205760 | Anti-NeuN Antibody | polyclonal | GST-tagged recombinant fragment corresponding to the first 97 amino acids from the N-terminal region of murine NeuN. | - | Milipore | ABN91 |
![]() | primary-0003 | AB_221570 | GFP Polyclonal Antibody | polyclonal | The GFP was isolated directly from the jellyfish Aequorea victoria. | - | A-6455 | ||
![]() | primary-0004 | COL4A1 | AB_2721907 | Goat Anti-Type IV Collagen-UNLB | polyclonal | - | SouthernBiotech | 1340-01 | |
![]() | primary-0005 | PECAM1 | AB_2801330 | PECAM-1 Antikörper (H-3) | monoclonal | aa 699-727 at the C-terminus | - | Santa Cruz Biotechnology | sc-376764 |
![]() | primary-0006 | AQP4 | AB_2039734 | Anti-Aquaporin 4 (AQP4) (249-323) Antibody | polyclonal | GST fusion protein with the sequence EYVFCPDVELKRRLKEAFSKAAQQTKGSYMEVEDNRSQVETEDLILKPGVVHVIDIDRGDEKKGKDSSGEVLSSV | - | Alomone Labs | AQP-004 |
![]() | primary-0007 | ACE2 | AB_355722 | Human/Mouse/Rat/Hamster ACE-2 Antibody | polyclonal | Mouse myeloma cell line NS0-derived recombinant human ACE-2, Gln18-Ser740, Accession # Q9BYF1 | - | R&D Systems | AF933 |
![]() | primary-0008 | NRP1 | AB_2282634 | neuropilin Antikörper (A-12) | monoclonal | amino acid sequence 570-855 of neuropilin in species human | - | Santa Cruz Biotechnology | sc-5307 |
![]() | primary-0009 | Anti-SARS spike glycoprotein antibody [3A2] - Coronavirus | monoclonal | - | Abcam | ab272420 | |||
![]() | primary-0010 | OLIG2 | AB_494617 | OLIG2 anti-human rabbit IgG affinity purify | polyclonal | Synthetic peptide in portion of C-terminus of Human Olig2 | - | Immuno-Biological Laboratories (IBL) | 18953 |
![]() | primary-0011 | SARS-CoV-2 (2019-nCoV) Spike RBD Antibody, Rabbit PAb, Antigen Affinity Purified | polyclonal | Recombinant SARS-CoV-2 / 2019-nCoV Spike/RBD Protein (Catalog#40592-V05H) | - | SinoBiological | 40592-T62 | ||
![]() | primary-0012 | TUBA1A | AB_301787 | Anti-alpha Tubulin antibody - Microtubule Marker | polyclonal | - | Abcam | ab15246 | |
![]() | primary-0108 | NRP1 | AB_1640739 | anti-neuropilin-1 | monoclonal | - | Abcam | AB81321 | |
![]() | primary-0025 | AB_2057371 | Anti-APC (Ab-7) Mouse mAb (CC-1) antibody | monoclonal | - | Millipore | OP80 | ||
![]() | primary-0026 | AB_839504 | Anti Iba1, Rabbit antibody | polyclonal | - | FUJIFILM Wako Shibayagi | 019-19741 | ||
![]() | primary-0027 | AB_570666 | Anti-Olig-2 Antibody | polyclonal | - | Millipore | AB9610 | ||
![]() | primary-0100 | APP | AB_2289606 | Recombinant Anti-Amyloid Precursor Protein antibody [Y188] | monoclonal | Synthetic peptide. This information is proprietary to Abcam and/or its suppliers. | - | Abcam | ab32136 |
![]() | primary-0101 | NICA | AB_477259 | Anti-Nicastrin antibody produced in rabbit | polyclonal | synthetic peptide corresponding to the C-terminus of human nicastrin (amino acids 693-709) conjugated to KLH. | - | N1660 | |
![]() | primary-0055 | AB_2619949 | Chicken anti-IBA1 | polyclonal | - | Synaptic Systems | 234 006 | ||
![]() | primary-0056 | AB_442102 | Ki-67 antibody | polyclonal | Prokaryotic recombinant fusion protein corresponding to a 1086bp Ki67 motif-containing cDNA fragment | - | Leica Biosystems | NCL-Ki67p | |
![]() | primary-0057 | AB_630987 | caspase-3 (L-18) antibody | polyclonal | - | Santa Cruz Biotechnology | sc-1225 | ||
![]() | primary-0058 | AB_2620065 | Anti-Ctip 2 antibody | unknown | Ctip 2 (C-terminus) | - | Synaptic Systems | 325 005 | |
![]() | primary-0059 | Recombinant Anti-TBR1 antibody [EPR8138(2)] | monoclonal | - | Abcam | ab183032 | |||
![]() | primary-0060 | AB_2620122 | Anti-Zbtb 20 antibody | polyclonal | - | Synaptic Systems | 362 003 | ||
![]() | primary-0072 | AB_221544 | Alexa Fluor 488 Polyclonal Antibody | polyclonal | Alexa Fluor 488 coupled to carrier protein | - | Thermo Fisher Scientific (Invitrogen) | A-11094 |