Adinda Wens
Technische Universität München
Fakultät für Medizin
Lehrstuhl für Molekulare Neurobiologie
Feodor-Lynen Strasse 17, 81377 Munich
Tel: +49-(0)-89-440046463
Primary antibodies
Search
AG | PID | Antigen Symbol | Antibody Registry | Name | Clonality | Antigen | Quality | Company | Catalog no. |
---|---|---|---|---|---|---|---|---|---|
primary-0071 | NEFH | AB_477257 | Anti-Neurofilament 200 (Phos. and Non-Phos.) antibody | monoclonal | C-terminal segment of enzymatically dephosphorylated pig neurofilament 200. | - | Sigma-Aldrich | N0142 | |
primary-0002 | NeuN | AB_11205760 | Anti-NeuN Antibody | polyclonal | GST-tagged recombinant fragment corresponding to the first 97 amino acids from the N-terminal region of murine NeuN. | - | Milipore | ABN91 | |
primary-0040 | NF | AB_2314899 | Neurofilament Protein antibody | monoclonal | Neurofilament isolated from normal adult human brain | - | Agilent (Dako) | M0762 | |
primary-0101 | NICA | AB_477259 | Anti-Nicastrin antibody produced in rabbit | polyclonal | synthetic peptide corresponding to the C-terminus of human nicastrin (amino acids 693-709) conjugated to KLH. | - | N1660 | ||
primary-0001 | NRP1 | AB_1640739 | anti-neuropilin-1 | monoclonal | - | Abcam | AB81321 | ||
primary-0008 | NRP1 | AB_2282634 | neuropilin Antikörper (A-12) | monoclonal | amino acid sequence 570-855 of neuropilin in species human | - | Santa Cruz Biotechnology | sc-5307 | |
primary-0010 | OLIG2 | AB_494617 | OLIG2 anti-human rabbit IgG affinity purify | polyclonal | Synthetic peptide in portion of C-terminus of Human Olig2 | - | Immuno-Biological Laboratories (IBL) | 18953 | |
primary-0065 | OMP | AB_664696 | Anti-Olfactory Marker Protein Antibody | polyclonal | Olfactory Marker Protein | - | Wako | 019-22291 | |
primary-0038 | P2RY12 | AB_2810254 | P2Y12/P2RY12 Antibody | polyclonal | Against a recombinant protein corresponding to amino acids: KSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM | - | Novus Biologicals | NBP2-33870 | |
primary-0104 | PARP1 | AB_10699459 | poly(ADP-ribose) polymerase 1 | monoclonal | large fragment (89 kDa) of human PARP1 protein produced by caspase cleavage. | - | Cell Signaling Technology | 5625 | |
primary-0005 | PECAM1 | AB_2801330 | PECAM-1 Antikörper (H-3) | monoclonal | aa 699-727 at the C-terminus | - | Santa Cruz Biotechnology | sc-376764 | |
primary-0033 | PLP1 | AB_2237198 | Myelin Proteolipid Protein antibody | monoclonal | Synthetic peptide GRGTKF corresponding to C terminal region of myelin proteolipid protein | - | Bio Rad | MCA839G | |
primary-0091 | PSN2 | AB_882202 | Recombinant Anti-Presenilin 2/AD5 antibody [EP1515Y] | monoclonal | Synthetic peptide within Human Presenilin 2/AD5 aa 300-400 (C terminal). The exact sequence is proprietary. | - | Abcam | ab51249 | |
primary-0061 | S100 | AB_10013383 | S100 antibody | polyclonal | S100 isolated from cow brain. | - | Agilent (Dako) | Z0311 | |
primary-0063 | S100A9 | AB_1007174 | S100A9 mouse monoclonal antibody | monoclonal | Cultured Human monocytes. | - | Origene (Acris) | BM4026B | |
primary-0076 | TFAM | AB_10717737 | TFAM MaxPab rabbit polyclonal antibody (D01) | polyclonal | TFAM (NP_003192.1, 1 a.a. ~ 246 a.a) full-length human protein. | - | Abnova | H00007019-D01 | |
primary-0037 | TMEM119 | AB_2681645 | Anti-TMEM119 antibody | polyclonal | transmembrane protein 119 recombinant protein epitope signature tag (PrEST) | - | Sigma-Aldrich (Atlas Antibodies) | HPA051870 | |
primary-0032 | TPPP | AB_2050408 | Recombinant Anti-TPPP antibody | monoclonal | Synthetic peptide within Human TPPP. The exact sequence is proprietary. | - | Abcam | ab92305 | |
primary-0097 | TREM2 | AB_2799888 | TREM2 (E7P8J) Rabbit mAb (Carboxy-terminal Antigen) | monoclonal | - | Cell Signaling Technology | 76765 | ||
primary-0012 | TUBA1A | AB_301787 | Anti-alpha Tubulin antibody - Microtubule Marker | polyclonal | - | Abcam | ab15246 | ||
primary-0066 | TUBB3 | Recombinant Anti-beta III Tubulin antibody | monoclonal | Synthetic peptide within Human beta III Tubulin aa 400 to the C-terminus. | - | Abcam | ab215037 |