Adinda Wens
Universitätsmedizin Göttingen
Institut für Neuroimmunologie und Multiple
Sklerose Forschung
Von-Siebold-Str. 3 a, 37075 Göttingen
Tel: +49-(0)-551-39-61160
E-mail: adinda.wens@med.uni-goettingen.de
AG | PID | Antigen Symbol | Antibody Registry | Name | Clonality | Antigen | Quality | Company | Catalog no. |
---|---|---|---|---|---|---|---|---|---|
![]() | primary-0097 | TREM2 | AB_2799888 | TREM2 (E7P8J) Rabbit mAb (Carboxy-terminal Antigen) | monoclonal | - | Cell Signaling Technology | 76765 | |
![]() | primary-0103 | GALNS | AB_11152499 | GALNS Polyclonal Antibody | polyclonal | - | Thermo Fisher Scientific (Invitrogen) | PA5-22098 | |
![]() | primary-0005 | PECAM1 | AB_2801330 | PECAM-1 Antikörper (H-3) | monoclonal | aa 699-727 at the C-terminus | - | Santa Cruz Biotechnology | sc-376764 |
![]() | primary-0064 | CD56 | AB_321501 | CD56 antibody | monoclonal | Human retinoblastoma tumour cells. | - | Bio Rad (Serotec) | MCA591 |
![]() | primary-0032 | TPPP | AB_2050408 | Recombinant Anti-TPPP antibody | monoclonal | Synthetic peptide within Human TPPP. The exact sequence is proprietary. | - | Abcam | ab92305 |
![]() | primary-0068 | ACE2 | AB_10732845 | ACE2 antibody | polyclonal | ACE2 fusion protein Ag15455 | - | Proteintech | 21115-1-AP |
![]() | primary-0038 | P2RY12 | AB_2810254 | P2Y12/P2RY12 Antibody | polyclonal | Against a recombinant protein corresponding to amino acids: KSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM | - | Novus Biologicals | NBP2-33870 |
![]() | primary-0072 | AB_221544 | Alexa Fluor 488 Polyclonal Antibody | polyclonal | Alexa Fluor 488 coupled to carrier protein | - | Thermo Fisher Scientific (Invitrogen) | A-11094 | |
![]() | primary-0008 | NRP1 | AB_2282634 | neuropilin Antikörper (A-12) | monoclonal | amino acid sequence 570-855 of neuropilin in species human | - | Santa Cruz Biotechnology | sc-5307 |
![]() | primary-0049 | AB_260581 | Monoclonal Anti-c-Myc antibody produced in mouse | monoclonal | c-Myc human | - | Sigma-Aldrich | M5546 | |
![]() | primary-0071 | NEFH | AB_477257 | Anti-Neurofilament 200 (Phos. and Non-Phos.) antibody | monoclonal | C-terminal segment of enzymatically dephosphorylated pig neurofilament 200. | - | Sigma-Aldrich | N0142 |
![]() | primary-0058 | AB_2620065 | Anti-Ctip 2 antibody | unknown | Ctip 2 (C-terminus) | - | Synaptic Systems | 325 005 | |
![]() | primary-0063 | S100A9 | AB_1007174 | S100A9 mouse monoclonal antibody | monoclonal | Cultured Human monocytes. | - | Origene (Acris) | BM4026B |
![]() | primary-0034 | MBP | AB_305869 | Anti-Myelin Basic Protein antibody | monoclonal | Full length protein corresponding to Cow Myelin Basic Protein. | - | Abcam | ab7349 |
![]() | primary-0050 | AB_300798 | Anti-GFP antibody | polyclonal | GFP | - | Abcam | ab13970 | |
![]() | primary-0006 | AQP4 | AB_2039734 | Anti-Aquaporin 4 (AQP4) (249-323) Antibody | polyclonal | GST fusion protein with the sequence EYVFCPDVELKRRLKEAFSKAAQQTKGSYMEVEDNRSQVETEDLILKPGVVHVIDIDRGDEKKGKDSSGEVLSSV | - | Alomone Labs | AQP-004 |
![]() | primary-0002 | NeuN | AB_11205760 | Anti-NeuN Antibody | polyclonal | GST-tagged recombinant fragment corresponding to the first 97 amino acids from the N-terminal region of murine NeuN. | - | Milipore | ABN91 |
![]() | primary-0044 | NEFH | AB_2566782 | Purified anti-Neurofilament Marker (pan axonal, cocktail) Antibody | monoclonal | Homogenized hypothalami recovered from Fischer 344 rats. | - | BioLegend | 837904 |
![]() | primary-0062 | KRT | AB_2132885 | Pan-Keratin antibody | monoclonal | Human epidermal callus1 | - | Agilent (Dako) | M3515 |
![]() | primary-0104 | PARP1 | AB_10699459 | poly(ADP-ribose) polymerase 1 | monoclonal | large fragment (89 kDa) of human PARP1 protein produced by caspase cleavage. | - | Cell Signaling Technology | 5625 |
![]() | primary-0102 | ARSA | AB_1078220 | Anti-ARSA antibody produced in rabbit | polyclonal | LLLGTGKSPRQSLFFYPSYPDEVRGVFAVRTGKYKAHFFTQGSAHSDTTADPACHASSSLTAHEPPLLYDLSKDPGENYNLLGGVAGATPEVLQALKQLQLLKAQLDAAVTFGPSQ | - | HPA005554 | |
![]() | primary-0073 | IMMT | AB_2127193 | Mitofilin antibody | polyclonal | Mitofilin fusion protein Ag0102 | - | Proteintech | 10179-1-AP |
![]() | primary-0007 | ACE2 | AB_355722 | Human/Mouse/Rat/Hamster ACE-2 Antibody | polyclonal | Mouse myeloma cell line NS0-derived recombinant human ACE-2, Gln18-Ser740, Accession # Q9BYF1 | - | R&D Systems | AF933 |
![]() | primary-0067 | NEFH | AB_477272 | Anti-Neurofilament 200 antibody | polyclonal | Neurofilament 200 from spinal cord of bovine | - | Sigma-Aldrich | N4142 |
![]() | primary-0040 | NF | AB_2314899 | Neurofilament Protein antibody | monoclonal | Neurofilament isolated from normal adult human brain | - | Agilent (Dako) | M0762 |