Adinda Wens
Technische Universität München
Fakultät für Medizin
Lehrstuhl für Molekulare Neurobiologie
Feodor-Lynen Strasse 17, 81377 Munich
Tel: +49-(0)-89-440046463
Primary antibodies
Search
AG | PID | Antigen Symbol | Antibody Registry | Name | Clonality | Antigen | Quality | Company | Catalog no. |
---|---|---|---|---|---|---|---|---|---|
primary-0037 | TMEM119 | AB_2681645 | Anti-TMEM119 antibody | polyclonal | transmembrane protein 119 recombinant protein epitope signature tag (PrEST) | - | Sigma-Aldrich (Atlas Antibodies) | HPA051870 | |
primary-0038 | P2RY12 | AB_2810254 | P2Y12/P2RY12 Antibody | polyclonal | Against a recombinant protein corresponding to amino acids: KSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM | - | Novus Biologicals | NBP2-33870 | |
primary-0039 | APP | AB_94882 | Anti-APP A4 Antibody | monoclonal | Purified recombinant Alzheimer precursor A4 (pre A4695) fusion protein. | - | Merck Millipore | MAB348 | |
primary-0040 | NF | AB_2314899 | Neurofilament Protein antibody | monoclonal | Neurofilament isolated from normal adult human brain | - | Agilent (Dako) | M0762 | |
primary-0041 | NEFH | AB_2650680 | Anti-Neurofilament H (NF-H) Phosphorylated Antibody | monoclonal | - | BioLegend | 801608 | ||
primary-0042 | NEFH | AB_2715852 | Purified anti-Neurofilament H (NF-H), Nonphosphorylated Antibody | monoclonal | - | BioLegend | 801702 | ||
primary-0043 | NEFH | AB_2565349 | Anti-Neurofilament H & M (NF-H/NF-M), Hypophosphorylated Antibody | monoclonal | - | BioLegend | 835601 | ||
primary-0044 | NEFH | AB_2566782 | Purified anti-Neurofilament Marker (pan axonal, cocktail) Antibody | monoclonal | Homogenized hypothalami recovered from Fischer 344 rats. | - | BioLegend | 837904 | |
primary-0061 | S100 | AB_10013383 | S100 antibody | polyclonal | S100 isolated from cow brain. | - | Agilent (Dako) | Z0311 | |
primary-0062 | KRT | AB_2132885 | Pan-Keratin antibody | monoclonal | Human epidermal callus1 | - | Agilent (Dako) | M3515 | |
primary-0063 | S100A9 | AB_1007174 | S100A9 mouse monoclonal antibody | monoclonal | Cultured Human monocytes. | - | Origene (Acris) | BM4026B | |
primary-0064 | CD56 | AB_321501 | CD56 antibody | monoclonal | Human retinoblastoma tumour cells. | - | Bio Rad (Serotec) | MCA591 | |
primary-0065 | OMP | AB_664696 | Anti-Olfactory Marker Protein Antibody | polyclonal | Olfactory Marker Protein | - | Wako | 019-22291 | |
primary-0066 | TUBB3 | Recombinant Anti-beta III Tubulin antibody | monoclonal | Synthetic peptide within Human beta III Tubulin aa 400 to the C-terminus. | - | Abcam | ab215037 | ||
primary-0067 | NEFH | AB_477272 | Anti-Neurofilament 200 antibody | polyclonal | Neurofilament 200 from spinal cord of bovine | - | Sigma-Aldrich | N4142 | |
primary-0068 | ACE2 | AB_10732845 | ACE2 antibody | polyclonal | ACE2 fusion protein Ag15455 | - | Proteintech | 21115-1-AP | |
primary-0070 | AQP4 | AB_258270 | Anti-Water Channel Aquaporin 4 antibody | polyclonal | recombinant fusion protein corresponding to residues 249-323 of rat AQP4 fused to GST. | - | Sigma-Aldrich | A5971 | |
primary-0071 | NEFH | AB_477257 | Anti-Neurofilament 200 (Phos. and Non-Phos.) antibody | monoclonal | C-terminal segment of enzymatically dephosphorylated pig neurofilament 200. | - | Sigma-Aldrich | N0142 | |
primary-0072 | AB_221544 | Alexa Fluor 488 Polyclonal Antibody | polyclonal | Alexa Fluor 488 coupled to carrier protein | - | Thermo Fisher Scientific (Invitrogen) | A-11094 | ||
primary-0073 | IMMT | AB_2127193 | Mitofilin antibody | polyclonal | Mitofilin fusion protein Ag0102 | - | Proteintech | 10179-1-AP | |
primary-0074 | AB_470907 | Anti-ds DNA antibody [35I9 DNA] - BSA and Azide free | monoclonal | The details of the immunogen for this antibody are not available. | - | Abcam | ab27156 | ||
primary-0075 | BrdU | AB_305426 | Anti-BrdU antibody [BU1/75 (ICR1)] - Proliferation Marker | monoclonal | The details of the immunogen for this antibody are not available. | - | Abcam | ab6326 | |
primary-0076 | TFAM | AB_10717737 | TFAM MaxPab rabbit polyclonal antibody (D01) | polyclonal | TFAM (NP_003192.1, 1 a.a. ~ 246 a.a) full-length human protein. | - | Abnova | H00007019-D01 | |
primary-0055 | AB_2619949 | Chicken anti-IBA1 | polyclonal | - | Synaptic Systems | 234 006 | |||
primary-0056 | AB_442102 | Ki-67 antibody | polyclonal | Prokaryotic recombinant fusion protein corresponding to a 1086bp Ki67 motif-containing cDNA fragment | - | Leica Biosystems | NCL-Ki67p |