Adinda Wens
Universitätsmedizin Göttingen
Institut für Neuroimmunologie und Multiple
Sklerose Forschung
Von-Siebold-Str. 3 a, 37075 Göttingen
Tel: +49-(0)-551-39-61160
E-mail: adinda.wens@med.uni-goettingen.de
AG | PID | Antigen Symbol | Antibody Registry | Name | Clonality | Antigen | Quality | Company | Catalog no. |
---|---|---|---|---|---|---|---|---|---|
![]() | primary-0074 | AB_470907 | Anti-ds DNA antibody [35I9 DNA] - BSA and Azide free | monoclonal | The details of the immunogen for this antibody are not available. | - | Abcam | ab27156 | |
![]() | primary-0075 | BrdU | AB_305426 | Anti-BrdU antibody [BU1/75 (ICR1)] - Proliferation Marker | monoclonal | The details of the immunogen for this antibody are not available. | - | Abcam | ab6326 |
![]() | primary-0076 | TFAM | AB_10717737 | TFAM MaxPab rabbit polyclonal antibody (D01) | polyclonal | TFAM (NP_003192.1, 1 a.a. ~ 246 a.a) full-length human protein. | - | Abnova | H00007019-D01 |
![]() | primary-0030 | GFAP | AB_10013382 | Glial Fibrillary Acidic Protein (Multipurpose) antibody | polyclonal | - | Agilent (Dako) | Z0334 | |
![]() | primary-0031 | MAG/GMA | AB_2042411 | Anti-MAG/GMA antibody | monoclonal | Recombinant fragment corresponding to Human MAG/GMA aa 119-208. | - | Abcam | ab89780 |
![]() | primary-0032 | TPPP | AB_2050408 | Recombinant Anti-TPPP antibody | monoclonal | Synthetic peptide within Human TPPP. The exact sequence is proprietary. | - | Abcam | ab92305 |
![]() | primary-0033 | PLP1 | AB_2237198 | Myelin Proteolipid Protein antibody | monoclonal | Synthetic peptide GRGTKF corresponding to C terminal region of myelin proteolipid protein | - | Bio Rad | MCA839G |
![]() | primary-0034 | MBP | AB_305869 | Anti-Myelin Basic Protein antibody | monoclonal | Full length protein corresponding to Cow Myelin Basic Protein. | - | Abcam | ab7349 |
![]() | primary-0035 | CNP | AB_2728547 | Purified anti-Myelin CNPase Antibody | monoclonal | - | BioLegend | 836403 | |
![]() | primary-0036 | BCAS1 | AB_10839529 | Anti-NaBC1 Antibody | monoclonal | raised against amino acids 365-571 of NaBC1 of human origin | - | Santa Cruz Biotechnology | sc-136342 |
![]() | primary-0037 | TMEM119 | AB_2681645 | Anti-TMEM119 antibody | polyclonal | transmembrane protein 119 recombinant protein epitope signature tag (PrEST) | - | Sigma-Aldrich (Atlas Antibodies) | HPA051870 |
![]() | primary-0038 | P2RY12 | AB_2810254 | P2Y12/P2RY12 Antibody | polyclonal | Against a recombinant protein corresponding to amino acids: KSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM | - | Novus Biologicals | NBP2-33870 |
![]() | primary-0039 | APP | AB_94882 | Anti-APP A4 Antibody | monoclonal | Purified recombinant Alzheimer precursor A4 (pre A4695) fusion protein. | - | Merck Millipore | MAB348 |
![]() | primary-0040 | NF | AB_2314899 | Neurofilament Protein antibody | monoclonal | Neurofilament isolated from normal adult human brain | - | Agilent (Dako) | M0762 |
![]() | primary-0041 | NEFH | AB_2650680 | Anti-Neurofilament H (NF-H) Phosphorylated Antibody | monoclonal | - | BioLegend | 801608 | |
![]() | primary-0042 | NEFH | AB_2715852 | Purified anti-Neurofilament H (NF-H), Nonphosphorylated Antibody | monoclonal | - | BioLegend | 801702 | |
![]() | primary-0043 | NEFH | AB_2565349 | Anti-Neurofilament H & M (NF-H/NF-M), Hypophosphorylated Antibody | monoclonal | - | BioLegend | 835601 | |
![]() | primary-0044 | NEFH | AB_2566782 | Purified anti-Neurofilament Marker (pan axonal, cocktail) Antibody | monoclonal | Homogenized hypothalami recovered from Fischer 344 rats. | - | BioLegend | 837904 |
![]() | primary-0061 | S100 | AB_10013383 | S100 antibody | polyclonal | S100 isolated from cow brain. | - | Agilent (Dako) | Z0311 |
![]() | primary-0062 | KRT | AB_2132885 | Pan-Keratin antibody | monoclonal | Human epidermal callus1 | - | Agilent (Dako) | M3515 |
![]() | primary-0063 | S100A9 | AB_1007174 | S100A9 mouse monoclonal antibody | monoclonal | Cultured Human monocytes. | - | Origene (Acris) | BM4026B |
![]() | primary-0064 | CD56 | AB_321501 | CD56 antibody | monoclonal | Human retinoblastoma tumour cells. | - | Bio Rad (Serotec) | MCA591 |
![]() | primary-0065 | OMP | AB_664696 | Anti-Olfactory Marker Protein Antibody | polyclonal | Olfactory Marker Protein | - | Wako | 019-22291 |
![]() | primary-0066 | TUBB3 | Recombinant Anti-beta III Tubulin antibody | monoclonal | Synthetic peptide within Human beta III Tubulin aa 400 to the C-terminus. | - | Abcam | ab215037 | |
![]() | primary-0067 | NEFH | AB_477272 | Anti-Neurofilament 200 antibody | polyclonal | Neurofilament 200 from spinal cord of bovine | - | Sigma-Aldrich | N4142 |