 |
primary-0073 |
IMMT |
AB_2127193 |
Mitofilin antibody |
polyclonal |
Mitofilin fusion protein Ag0102 |
|
Proteintech |
10179-1-AP |
|
primary-0074 |
|
AB_470907 |
Anti-ds DNA antibody [35I9 DNA] - BSA and Azide free |
monoclonal |
The details of the immunogen for this antibody are not available. |
|
Abcam |
ab27156 |
|
primary-0075 |
BrdU |
AB_305426 |
Anti-BrdU antibody [BU1/75 (ICR1)] - Proliferation Marker |
monoclonal |
The details of the immunogen for this antibody are not available. |
|
Abcam |
ab6326 |
|
primary-0076 |
TFAM |
AB_10717737 |
TFAM MaxPab rabbit polyclonal antibody (D01) |
polyclonal |
TFAM (NP_003192.1, 1 a.a. ~ 246 a.a) full-length human protein. |
|
Abnova |
H00007019-D01 |
|
primary-0030 |
GFAP |
AB_10013382 |
Glial Fibrillary Acidic Protein (Multipurpose) antibody |
polyclonal |
|
|
Agilent (Dako) |
Z0334 |
|
primary-0031 |
MAG/GMA |
AB_2042411 |
Anti-MAG/GMA antibody |
monoclonal |
Recombinant fragment corresponding to Human MAG/GMA aa 119-208. |
|
Abcam |
ab89780 |
|
primary-0032 |
TPPP |
AB_2050408 |
Recombinant Anti-TPPP antibody |
monoclonal |
Synthetic peptide within Human TPPP. The exact sequence is proprietary. |
|
Abcam |
ab92305 |
|
primary-0033 |
PLP1 |
AB_2237198 |
Myelin Proteolipid Protein antibody |
monoclonal |
Synthetic peptide GRGTKF corresponding to C terminal region of myelin proteolipid protein |
|
Bio Rad |
MCA839G |
|
primary-0034 |
MBP |
AB_305869 |
Anti-Myelin Basic Protein antibody |
monoclonal |
Full length protein corresponding to Cow Myelin Basic Protein. |
|
Abcam |
ab7349 |
|
primary-0035 |
CNP |
AB_2728547 |
Purified anti-Myelin CNPase Antibody |
monoclonal |
|
|
BioLegend |
836403 |
|
primary-0036 |
BCAS1 |
AB_10839529 |
Anti-NaBC1 Antibody |
monoclonal |
raised against amino acids 365-571 of NaBC1 of human origin |
|
Santa Cruz Biotechnology |
sc-136342 |
|
primary-0037 |
TMEM119 |
AB_2681645 |
Anti-TMEM119 antibody |
polyclonal |
transmembrane protein 119 recombinant protein epitope signature tag (PrEST) |
|
Sigma-Aldrich (Atlas Antibodies) |
HPA051870 |
|
primary-0038 |
P2RY12 |
AB_2810254 |
P2Y12/P2RY12 Antibody |
polyclonal |
Against a recombinant protein corresponding to amino acids: KSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM |
|
Novus Biologicals |
NBP2-33870 |
|
primary-0039 |
APP |
AB_94882 |
Anti-APP A4 Antibody |
monoclonal |
Purified recombinant Alzheimer precursor A4 (pre A4695) fusion protein. |
|
Merck Millipore |
MAB348 |
|
primary-0040 |
NF |
AB_2314899 |
Neurofilament Protein antibody |
monoclonal |
Neurofilament isolated from normal adult human brain |
|
Agilent (Dako) |
M0762 |
|
primary-0041 |
NEFH |
AB_2650680 |
Anti-Neurofilament H (NF-H) Phosphorylated Antibody |
monoclonal |
|
|
BioLegend |
801608 |
|
primary-0042 |
NEFH |
AB_2715852 |
Purified anti-Neurofilament H (NF-H), Nonphosphorylated Antibody |
monoclonal |
|
|
BioLegend |
801702 |
|
primary-0043 |
NEFH |
AB_2565349 |
Anti-Neurofilament H & M (NF-H/NF-M), Hypophosphorylated Antibody |
monoclonal |
|
|
BioLegend |
835601 |
|
primary-0044 |
NEFH |
AB_2566782 |
Purified anti-Neurofilament Marker (pan axonal, cocktail) Antibody |
monoclonal |
Homogenized hypothalami recovered from Fischer 344 rats. |
|
BioLegend |
837904 |
|
primary-0061 |
S100 |
AB_10013383 |
S100 antibody |
polyclonal |
S100 isolated from cow brain. |
|
Agilent (Dako) |
Z0311 |
|
primary-0062 |
KRT |
AB_2132885 |
Pan-Keratin antibody |
monoclonal |
Human epidermal callus1 |
|
Agilent (Dako) |
M3515 |
|
primary-0063 |
S100A9 |
AB_1007174 |
S100A9 mouse monoclonal antibody |
monoclonal |
Cultured Human monocytes. |
|
Origene (Acris) |
BM4026B |
|
primary-0064 |
CD56 |
AB_321501 |
CD56 antibody |
monoclonal |
Human retinoblastoma tumour cells. |
|
Bio Rad (Serotec) |
MCA591 |
|
primary-0065 |
OMP |
AB_664696 |
Anti-Olfactory Marker Protein Antibody |
polyclonal |
Olfactory Marker Protein |
|
Wako |
019-22291 |
|
primary-0066 |
TUBB3 |
|
Recombinant Anti-beta III Tubulin antibody |
monoclonal |
Synthetic peptide within Human beta III Tubulin aa 400 to the C-terminus. |
|
Abcam |
ab215037 |